PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00106.21
Common NameAMTR_s00106p00040830
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family G2-like
Protein Properties Length: 199aa    MW: 23076.4 Da    PI: 7.7598
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00106.21genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.42.9e-322174255
                                  G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                                             prlrWtp+LH rFv ave+LGG+ kAtPk +lelm+vkgLtl+hvkSHLQ+YR+
  evm_27.model.AmTr_v1.0_scaffold00106.21 21 PRLRWTPDLHLRFVAAVERLGGEYKATPKLVLELMEVKGLTLAHVKSHLQMYRS 74
                                             9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.8261777IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.0E-311776IPR009057Homeodomain-like
SuperFamilySSF466898.96E-161976IPR009057Homeodomain-like
TIGRFAMsTIGR015577.5E-242175IPR006447Myb domain, plants
PfamPF002494.6E-92273IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 199 aa     Download sequence    Send to blast
MEEFMMGRKI CGRRYNRSRH PRLRWTPDLH LRFVAAVERL GGEYKATPKL VLELMEVKGL  60
TLAHVKSHLQ MYRSMKNEEG GEDHFLKRPG EVIDSSSLCG IRKRMISPTV DHHQHVHHQG  120
AFKFELGFPV QWNSYEESCA PLKELGLLDS LKKKSKTSME DEEAYKGGVD EEVMTPYRHP  180
HKVREIKEEE EESTDMKT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLW1NYG21e-146W1NYG2_AMBTC; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP28515123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.14e-29G2-like family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]